Scaffold RCM34_1102007

Overview

Basic Information

• Taxon OID: 3300001843
• Scaffold ID: RCM34_1102007
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 565
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Ponta de Pedras, Para, Brazil
• Coordinates
  • Lat. (^o): -1.519367
  • Long. (^o): -48.91795

Associated Families

Family	Category	Number of Sequences	3D Structure?
F070991	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
RCM34_11020071	F070991	N/A	RSEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*