Scaffold RCM30_1012608

Overview

Basic Information

• Taxon OID: 3300001842
• Scaffold ID: RCM30_1012608
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 942
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Afu?, Para, Brazil
• Coordinates
  • Lat. (^o): -0.156917
  • Long. (^o): -50.62255

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032818	Metagenome / Metatranscriptome	179	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM30_10126082	F032818	AGGAG	MSKSTVNFVNTVSIKELRTLIPLIGSEITPIIQSEPGCGKTSLLSMMREDLGDDYDYIYVDCPVKDMQDIGMVIPNHATKTLEYYVAELFKLDSPKPKV