Scaffold RCM27_1014995

Overview

Basic Information

• Taxon OID: 3300001836
• Scaffold ID: RCM27_1014995
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 619
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → actinobacterium SCGC AAA024-D14 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Afu?, Para, Brazil
• Coordinates
  • Lat. (^o): -0.083883
  • Long. (^o): -51.051417

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000766	Metagenome / Metatranscriptome	899	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM27_10149952	F000766	N/A	VAFKFTLSRDGTTTSSGPTFKGYQVKATIATPRQRLLKIPVFCYDVETDRFNVVTGXXXXXXXXXXLLEDAEANGDVLNWQDLTSGESRQVTIEQLSFTRLTPPDKRFSGFGGIIDIILRTV*