| Basic Information | |
|---|---|
| Taxon OID | 3300001834 Open in IMG/M |
| Scaffold ID | ACM2_1000819 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2g |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3912 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (57.14%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon River plume to Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 10.2885 | Long. (o) | -54.512 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F004144 | Metagenome / Metatranscriptome | 451 | Y |
| F005433 | Metagenome / Metatranscriptome | 401 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ACM2_10008194 | F004144 | GAG | MIKWFRNSIHHLKVETGWGYFYHLWHSLCNSWALIVIAFKSVVHGLIPSVWKADAPKGVIRMYHQIMRIEHIAKMDKLRKIPKDERYESDKPIDPVE* |
| ACM2_10008197 | F005433 | AGGAG | MIRTRYEIETFVLGAHPSPARKAQVLTEELMKARETSHPDLPVLEAIYKDFSAEHNVEELQKGIEESEEEYWVHRLAKLAAIDILTIGKVQPEHMSYMVALPDEAFKASVKEATSIAKQLNYEVQQIEAELQADLASAK* |
| ⦗Top⦘ |