Scaffold ACM4_1003842

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACM4_1003842

Scaffold ACM4_1003842

Overview

Basic Information
Taxon OID	3300001831 Open in IMG/M
Scaffold ID	ACM4_1003842 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM4, ROCA_DNA074_0.2um_10l
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	7715
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (36.84%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon River plume to Atlantic Ocean
Coordinates	Lat. (^o)	4.8818	Long. (^o)	-51.3608	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101001	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM4_10038427	F101001	GGAG	MIELWIDDEYLEDVTNSNIPEADIHYEAEHSCYRVIIRHINEMYWLTQDWGTIAEHFGFQPESVVYCH*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.