Scaffold ACM40_1019801

Overview

Basic Information

• Taxon OID: 3300001830
• Scaffold ID: ACM40_1019801
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2803
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 7.2875
  • Long. (^o): -53.0005

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003898	Metagenome / Metatranscriptome	463	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM40_10198017	F003898	N/A	MDSLRTTGMTTGFGVLYWTDIVSGILMCLMFAIQIYYLYLKVKKIKE*