Scaffold ACM55_1058420

Overview

Basic Information

• Taxon OID: 3300001829
• Scaffold ID: ACM55_1058420
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM55, ROCA_DNA132_0.2um_27g
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 502
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium TMED8 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 12.4145
  • Long. (^o): -52.2197

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041434	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM55_10584201	F041434	GGA	MKINNKEVIKFTKDDIKSVRLDSHRYDTWATITLKSGVEIRSHSFEFEQLVLDKYKSYIAFGANVHTWLSNNNGEDF