Scaffold ACM55_1007193

Overview

Basic Information

• Taxon OID: 3300001829
• Scaffold ID: ACM55_1007193
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM55, ROCA_DNA132_0.2um_27g
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 720
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Cercozoa → Imbricatea → Silicofilosea → Euglyphida → Paulinellidae → Paulinella → Paulinella micropora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 12.4145
  • Long. (^o): -52.2197

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004842	Metagenome / Metatranscriptome	421	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM55_10071931	F004842	N/A	SKVAKERGNKTFDGDIFLRSHQPSIKGNKDATTGVLGTIPDIGAIKKAIKEINFLGVLILSEEINSLTLSKAPLLNNAEETANKPIRVIKDGLPNPAKAFSGERTPVAINIPTHNKPVNSGAIVFLINKIIDIIKTTTVINASKLLLTTAIKFIRNLFNSIYPKTIFQKSLIGIIFFKKLFKNRFFLEYP*