| Basic Information | |
|---|---|
| Taxon OID | 3300001828 Open in IMG/M |
| Scaffold ID | ACM3_1002912 Open in IMG/M |
| Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1508 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (16.67%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Amazon River plume to Atlantic Ocean | |||||||
| Coordinates | Lat. (o) | 4.8818 | Long. (o) | -51.3608 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005412 | Metagenome / Metatranscriptome | 401 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| ACM3_10029121 | F005412 | N/A | RHTQNNMELTKSFPPADAFLEMMTEIDYKKHYNTFMDGVENLCLIIAAIATVIAQKWQEHNMTERTQLFVLRVIDGAKTFYAWVKNVFVPECQEFYNDIRSFYNYVRTI* |
| ⦗Top⦘ |