Scaffold ACM3_1001687

Overview

Basic Information

• Taxon OID: 3300001828
• Scaffold ID: ACM3_1001687
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 21956
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 10 (45.45%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Gammaproteobacteria incertae sedis → SAR86 cluster → SAR86 cluster bacterium SAR86E (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 4.8818
  • Long. (^o): -51.3608

Associated Families

Family	Category	Number of Sequences	3D Structure?
F075604	Metagenome / Metatranscriptome	118	N

Sequences

Protein ID	Family	RBS	Sequence
ACM3_100168714	F075604	N/A	MSKFISIVFLIFLSHPLLANEKLLSKVRGAFQQSYSFEEGAFDDTASKVSYSKGNFIFNDNDYRIIIQEPLSEEYVLNSQGLTILDYEFNQEEFIPLEQIQNPFIALLLSSEFLFLDIAITNKENVYSISHADFMQPVEITLFENKVELVRYIDQLNVTHIINFSSS*