Scaffold ACM20_114445

Overview

Basic Information

• Taxon OID: 3300001826
• Scaffold ID: ACM20_114445
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 533
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium TMED228 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 10.6822
  • Long. (^o): -54.4213

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048331	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
ACM20_1144452	F048331	N/A	MSILDLKKEFKKRKLKLTHCVESLEELNDYLTIDLLKRGNIDATLVALISATMTLSSQYNKKKFIIDLFSSALATIESEKYRDEGNKLN*