Basic Information | |
---|---|
Taxon OID | 3300001826 Open in IMG/M |
Scaffold ID | ACM20_107367 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3837 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 8 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon River plume to Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 10.6822 | Long. (o) | -54.4213 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F021014 | Metagenome | 221 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ACM20_1073675 | F021014 | AGGAG | MGYELKDGDIAVVISPDLDEDGAWTGILKTGLVFGESQHPLAMRNAMDYALTMAAASEVLEDYPELMDYFDEARHRILTKQYAETELELDKEMEYTKEGNVIKLTKWTKTMGEA* |
⦗Top⦘ |