| Basic Information | |
|---|---|
| Taxon OID | 3300001813 Open in IMG/M |
| Scaffold ID | JGI24123J20310_1000004 Open in IMG/M |
| Source Dataset Name | Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 342075 |
| Total Scaffold Genes | 309 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 196 (63.43%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Ignavibacteriae → Ignavibacteria → Ignavibacteriales | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy) |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: California, McLaughlin Reserve | |||||||
| Coordinates | Lat. (o) | 38.8739528 | Long. (o) | -122.4391613 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F045540 | Metagenome | 152 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24123J20310_1000004113 | F045540 | AGGAGG | MSVISMGGNDMSKYIFTLATLLDSKSKIKKHYSPDTVIADLFDENLDEIDFIKSLPELELIYGFEIPADLYDKTDLTLREFADELSQLTIITEELYPEFFDIKFTSLKLTKRWIELENKTDEDSLREMQIINEKFAELDDRLNVVLGNVLIN* |
| ⦗Top⦘ |