| Basic Information | |
|---|---|
| Taxon OID | 3300001810 Open in IMG/M |
| Scaffold ID | JGI20221J20338_1037412 Open in IMG/M |
| Source Dataset Name | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 543 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Culicinae → Culicini → Culex → Culex → Culex pipiens complex → Culex quinquefasciatus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | California, United States | |||||||
| Coordinates | Lat. (o) | 38.1075 | Long. (o) | -121.6497 | Alt. (m) | Depth (m) | 0 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F011845 | Metagenome / Metatranscriptome | 286 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20221J20338_10374121 | F011845 | N/A | GFTVRFSDPSACGHSLRGTVPRINRQLLAITAFQHVTGHSNRRVVIGRNPAGAGISIRPFARSQRRFRHHCEVHVPGLHLRSHTENLRESVRSPAPPLRSVSRPNRGDINTRNPFSAPISSAPDRSPASTPLRVLFRKPSGSKRSTGSLSGSPPCLTFDCLSLPGPLPLAIPLQINA* |
| ⦗Top⦘ |