Scaffold JGI20217J20340_10145

Overview

Basic Information

• Taxon OID: 3300001801
• Scaffold ID: JGI20217J20340_10145
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 509
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.1072
  • Long. (^o): -121.6485
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051759	Metagenome / Metatranscriptome	143	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20217J20340_101452	F051759	GGA	MGFAQAGVVAGEGKAVTSDQPQAGEKKGCDAPGSIDPVAGENGCRGAERRSVQRSRLRCSVPGMPVVGKAANRV