| Basic Information | |
|---|---|
| Taxon OID | 3300001789 Open in IMG/M |
| Scaffold ID | BP130528S2_1710598 Open in IMG/M |
| Source Dataset Name | BioPara_130528_S2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 500 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Shimazuella → Shimazuella kribbensis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | ||||||||
| Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070019 | Metagenome / Metatranscriptome | 123 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| BP130528S2_17105981 | F070019 | N/A | EKEFIEDDKVDFILDLFSKAGKKLDDSVKIVYEHGLEEDGSGGIEDYEVVKYMQFAQNLSYNDYVILNAINEKANLLGIIDELGISKDRLNKSLEILEQNGYIKGFDITRNGKNILKNTNIQVVRTYYRYTVKPGLGDPIIPSSRKFCIQMITENRIYTKKEIDMI |
| ⦗Top⦘ |