NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BP130528S2_1710598

Scaffold BP130528S2_1710598


Overview

Basic Information
Taxon OID3300001789 Open in IMG/M
Scaffold IDBP130528S2_1710598 Open in IMG/M
Source Dataset NameBioPara_130528_S2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)500
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Thermoactinomycetaceae → Shimazuella → Shimazuella kribbensis(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070019Metagenome / Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
BP130528S2_17105981F070019N/AEKEFIEDDKVDFILDLFSKAGKKLDDSVKIVYEHGLEEDGSGGIEDYEVVKYMQFAQNLSYNDYVILNAINEKANLLGIIDELGISKDRLNKSLEILEQNGYIKGFDITRNGKNILKNTNIQVVRTYYRYTVKPGLGDPIIPSSRKFCIQMITENRIYTKKEIDMI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.