| Basic Information | |
|---|---|
| Taxon OID | 3300001781 Open in IMG/M |
| Scaffold ID | Deep_1021218 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1718 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Mid Cayman Rise, Cayman Islands, UK | |||||||
| Coordinates | Lat. (o) | 18.35 | Long. (o) | -81.85 | Alt. (m) | Depth (m) | 4000 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F001242 | Metagenome / Metatranscriptome | 739 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Deep_10212184 | F001242 | N/A | MKIEGNWIILKGITGHGKNRIREHGDLWEVLDLPPGVMSMTPKPPLPPIKSLKTGEWRWLDDINFEFRLESTT* |
| ⦗Top⦘ |