NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Deep_1010264

Scaffold Deep_1010264


Overview

Basic Information
Taxon OID3300001781 Open in IMG/M
Scaffold IDDeep_1010264 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2990
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (70.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location
Location NameMid Cayman Rise, Cayman Islands, UK
CoordinatesLat. (o)18.35Long. (o)-81.85Alt. (m)Depth (m)4000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010829Metagenome / Metatranscriptome298Y
F020814Metagenome / Metatranscriptome222Y
F045695Metagenome / Metatranscriptome152Y

Sequences

Protein IDFamilyRBSSequence
Deep_10102641F010829AGGAGMGNLADSRRLREAKGLYRDNPGTGSITKSEMVYIPFLGNNPSDEKPAVYTGRFNMPSGVIELEAKRSGGKLHITCECDEKLNRAVFECMEIFVKAIFDGTAREIKEAGPEDSKIKKLRKELA
Deep_10102647F045695N/AMNSKREAFLRIWNKEAPKIRDTIKQKLIVRGIEPTQMNCYEYWMGYIKPWKNTRGDVTHLNPYRNEGFMRSIGRTKYGTPYNMARRNKKKKR*
Deep_10102649F020814GGAMGRSKGNLGRGVPAIVSNPPNKALNPEWWKDEKNLMRLDSSYKEHRRNYEQKKQQKKPT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.