NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ACM18_1118884

Scaffold ACM18_1118884


Overview

Basic Information
Taxon OID3300001778 Open in IMG/M
Scaffold IDACM18_1118884 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameAmazon River plume to Atlantic Ocean
CoordinatesLat. (o)7.2875Long. (o)-53.0005Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001419Metagenome / Metatranscriptome698Y
F002883Metagenome / Metatranscriptome523Y

Sequences

Protein IDFamilyRBSSequence
ACM18_11188842F002883GGAMSTLHHEDHLLTIFEEVQEAFPYLDEEKQIEIANNRFQELCQ*
ACM18_11188843F001419N/AMSIDYNEILKCYDGVDDIHASTSFEFGLMNDLYYQLFHNYDYD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.