| Basic Information | |
|---|---|
| Taxon OID | 3300001773 Open in IMG/M |
| Scaffold ID | DRAFT_1002448 Open in IMG/M |
| Source Dataset Name | Glenwood Hot Springs L4M |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1889 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Thermal Springs → Unclassified → Unclassified → Subterranean Sulfidic Spring → Subterranean Sulfidic Spring Microbial Communities From The Max Planck Institute, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Glenwood Hot Springs, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 39.54798 | Long. (o) | -107.3226 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F033261 | Metagenome / Metatranscriptome | 178 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| DRAFT_10024483 | F033261 | N/A | GQEFAHRIGKHHLAFDILPPGYTLTTTRDEDGHLQRQVEYDTTSFFLSAWLHCLGFNLMTLFGQALGGECTKMWAGTLLRKFIRRPATLYLVGKELHVVFDPFPDQEELRPLLEELNAKRVAIPWLNGLIIQFSIADHEPIHPLKVHKNRNRIFGHQ* |
| ⦗Top⦘ |