NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Beebe_1005993

Scaffold Beebe_1005993


Overview

Basic Information
Taxon OID3300001771 Open in IMG/M
Scaffold IDBeebe_1005993 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe Sites
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3269
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (44.44%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location
Location NameBeebe Vents, Mid Cayman Rise
CoordinatesLat. (o)18.35Long. (o)-81.85Alt. (m)Depth (m)4000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023622Metagenome / Metatranscriptome209Y
F101353Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Beebe_10059936F023622GAGGMKTFKEFQGETPTQRVEQVYFKVSIPDMSTMFMKATSESAVKLDMRKKLKPDVVKEVTIERVTKAEMRKIYRAMGQGKEDEKEKEPAEEK*
Beebe_10059939F101353N/ATFKQYVKEAQAPFNTRSMIFVNYESPALILSSTMIDRIFGQTKVDAWHVTDLDGLKGLKRIEGKKSSISVLTDIEPGRVKIFTKGVETGGGYCVSLEGSLLVSADFDIYSERLEGGRRAIAIGSEDYPNLYKDMIKMQDKMWNKYGEKGKLDAGQDFNKLGNSLTQKQKGQFVKEWIDNCESILMKNKKAQEELRKFGRSDWSTYNESVINQIKIKRIYVINDNKLERFGKSYELAKKEFKDVIEVTSKRMGEIIKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.