NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24118J20152_100555

Scaffold JGI24118J20152_100555


Overview

Basic Information
Taxon OID3300001767 Open in IMG/M
Scaffold IDJGI24118J20152_100555 Open in IMG/M
Source Dataset NameSerpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_CSW11AC
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3382
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location
Location NameUSA: California, McLaughlin Reserve
CoordinatesLat. (o)38.8739528Long. (o)-122.4391613Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F090615Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
JGI24118J20152_1005551F090615N/AAPVPAPAQKPTPAASGTLTRSEKLAQMRALQLAAPEPTDPSLIAALRVRKGWLRPDSPIVDKAAAEGLKKLGVLLCPPPDPDGKSIPERRFIDIATEYLKAVPQARLLIEESAVEHQASWDPDKVYVERTDADIHEEMVTAIKIANGERLRAARAKASAGS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.