| Basic Information | |
|---|---|
| Taxon OID | 3300001761 Open in IMG/M |
| Scaffold ID | CSTRM36_1004116 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Belvaux, Luxembourg - M36 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2467 |
| Total Scaffold Genes | 7 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (85.71%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Belvaux, Luxembourg | |||||||
| Coordinates | Lat. (o) | 49.506095 | Long. (o) | 5.943536 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F029455 | Metagenome / Metatranscriptome | 188 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| CSTRM36_10041164 | F029455 | GAG | MADRVIDLDLWGEGAERLPAITITGQGLRIEGSQAEFDRLILIIGGWMK* |
| ⦗Top⦘ |