NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM36_1002078

Scaffold CSTRM36_1002078


Overview

Basic Information
Taxon OID3300001761 Open in IMG/M
Scaffold IDCSTRM36_1002078 Open in IMG/M
Source Dataset NameWastewater microbial communities from Belvaux, Luxembourg - M36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1160
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Synergistetes → unclassified Synergistota → Synergistetes bacterium ADurb.BinA166(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003987Metagenome / Metatranscriptome458Y
F085852Metagenome / Metatranscriptome111N

Sequences

Protein IDFamilyRBSSequence
CSTRM36_10020781F085852AGGAGGMTFAPKEVILGATVPLTNGSTITFSIAGHVEAERDYDDAIVIFGRKLLKYTNCATDADRLTVRQVVASITSTPLDKVPDVG
CSTRM36_10020783F003987N/AAFYVAAFEGGDQTHHVGEYRIETVIRALGALQACGYDDVEVGSIEQGGKQHLLLIGLDGEARFGDRQLGCIAVLPVGVE*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.