NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CSTRM36_1001937

Scaffold CSTRM36_1001937


Overview

Basic Information
Taxon OID3300001761 Open in IMG/M
Scaffold IDCSTRM36_1001937 Open in IMG/M
Source Dataset NameWastewater microbial communities from Belvaux, Luxembourg - M36
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2427
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanomicrobiales(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location NameBelvaux, Luxembourg
CoordinatesLat. (o)49.506095Long. (o)5.943536Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017851Metagenome / Metatranscriptome238Y

Sequences

Protein IDFamilyRBSSequence
CSTRM36_10019374F017851AGGAGMTPTLSRQFFETFPPEVARGILEGDRLRVHAAKASVVRDKTGAAFAIDTLPRDGRPAEWERTTQRICRILKGEVDRLPAETKRALAAVAHILPAGEPILLFQVETWLSMKDDGGSWWEVPAYLSLAAISLPAVVKASEQAKKRILKVVTAI*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.