Basic Information | |
---|---|
Taxon OID | 3300001759 Open in IMG/M |
Scaffold ID | CSTRM44_103971 Open in IMG/M |
Source Dataset Name | Wastewater microbial communities from Belvaux, Luxembourg - M44 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1730 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Belvaux, Luxembourg | |||||||
Coordinates | Lat. (o) | 49.506095 | Long. (o) | 5.943536 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F022442 | Metagenome / Metatranscriptome | 214 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
CSTRM44_1039714 | F022442 | AGGAGG | MTFIPAGEARLDLYTDAMLLDIGPDTFVVPLDRLADLTAHRRHEVAVSRRYWGDAPGKFCDVELGIWLRRSQTDRSLMLTEQGRVYSIPVYLVLEVKDGIRESCTISMLVTDARQLDDAHSRQTVLEV* |
⦗Top⦘ |