Scaffold CSTRM44_102595

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold CSTRM44_102595

Scaffold CSTRM44_102595

Overview

Basic Information
Taxon OID	3300001759 Open in IMG/M
Scaffold ID	CSTRM44_102595 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Belvaux, Luxembourg - M44
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1469
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → Parcubacteria group → unclassified Parcubacteria group → Parcubacteria group bacterium ADurb.Bin216	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location
Location Name	Belvaux, Luxembourg
Coordinates	Lat. (^o)	49.506095	Long. (^o)	5.943536	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072352	Metagenome / Metatranscriptome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
CSTRM44_1025952	F072352	GGGGG	MSSKTSRIADLRRAPTVVHLPGCPNGCGEMLALDDGWQCPMCNWYRGYYRGERHP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.