Scaffold CSTRM44_100573

Overview

Basic Information

• Taxon OID: 3300001759
• Scaffold ID: CSTRM44_100573
• Source Dataset Name: Wastewater microbial communities from Belvaux, Luxembourg - M44
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1357
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division TA06 → candidate division TA06 bacterium 34_109 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater → Wastewater Microbial Communities From Belvaux, Luxembourg

Source Dataset Sampling Location

• Location Name: Belvaux, Luxembourg
• Coordinates
  • Lat. (^o): 49.506095
  • Long. (^o): 5.943536

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021489	Metagenome / Metatranscriptome	218	N

Sequences

Protein ID	Family	RBS	Sequence
CSTRM44_1005732	F021489	AGGAG	MTTFERKIESTQEYNLLKLLKANSNLKRFGVEWIKLNHELCRVFATNGYAMIVADLEPNWWHDIFDGLPELTLITKLKRDEVHYFEGKELENFNYLSVFEAVGREPNYVPVMHLDLNLLRKLTDKFDDVYFVKQSGLALFMKLEGDKYPAGSYYGALMPKSISQEETAKIIDALGSLATDGEIRRQWVADLREFAQE*