Scaffold JGI24659J20068_1008099

Overview

Basic Information

• Taxon OID: 3300001736
• Scaffold ID: JGI24659J20068_1008099
• Source Dataset Name: Marine viral communities from the Deep Pacific Ocean - MSP-131
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1002
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Mediterranean phage uvDeep-CGR2-KM23-C198 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location

• Location Name: Atlantic Ocean
• Coordinates
  • Lat. (^o): 17.4274
  • Long. (^o): -59.8286

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080240	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24659J20068_10080994	F080240	GAGG	MSFLAKIKPNILIAILAITALGLLVSFMGFKMEQEGIITGAGIGSIVAIANLATKILDG