Scaffold JGI24520J20079_1001925

Overview

Basic Information

• Taxon OID: 3300001735
• Scaffold ID: JGI24520J20079_1001925
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-45
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1318
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0454
  • Long. (^o): -144.8791

Associated Families

Family	Category	Number of Sequences	3D Structure?
F053568	Metagenome / Metatranscriptome	141	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24520J20079_10019252	F053568	AGG	MTIKNTHNMEDGQTFKIKYTKLDGEEVERNAKFILGKCGEYISKAGNKLFTYFDVDQSNHMGGDQYRSARDNWEIK*