NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24514J20073_1013399

Scaffold JGI24514J20073_1013399


Overview

Basic Information
Taxon OID3300001731 Open in IMG/M
Scaffold IDJGI24514J20073_1013399 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-37
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)825
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)50.0Long. (o)-145.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001712Metagenome / Metatranscriptome648Y
F002529Metagenome / Metatranscriptome551Y

Sequences

Protein IDFamilyRBSSequence
JGI24514J20073_10133991F002529GAGGMTYGYDDVTTTALGTGTAETQLNSGTSLSAPDPAHAFLACIPYQSESAAFTVDQSLLTAFRIQSDDVAVEPKKFVLPNVNTGDAAFTSVAAPALLAYPINTPLAGGEHLNFYGQPLVANTVQPICGATVIYDTESTNGAEQYYT
JGI24514J20073_10133992F001712N/ALAFLSNVTGSDMSASAGQPIGARAQNFGNSLLGRISGYTPFKNAAGAGTPQTIGIDGIFNKWSGIGLASTVYGMLPLKMLPHKGKAKTLGKSLLTAGVLSGLFMPTNNHSSNLISSTPITVTSSEVSYT*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.