Scaffold JGI24521J20086_1001175

Overview

Basic Information

• Taxon OID: 3300001728
• Scaffold ID: JGI24521J20086_1001175
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-46
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4262
• Total Scaffold Genes: 11
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (63.64%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 49.9991
  • Long. (^o): -144.9989

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081441	Metagenome / Metatranscriptome	114	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24521J20086_10011758	F081441	AGCAGG	MLSSREKFISFYSMFLTSHAALGVDPKELDEDGMGHVFNAVLDTVRMSVCPDLSDEEAKGIAEDYNMEMFKIRTVLDEAMRNHKLGERV*