Scaffold JGI24653J20064_1016596

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24653J20064_1016596

Scaffold JGI24653J20064_1016596

Overview

Basic Information
Taxon OID	3300001726 Open in IMG/M
Scaffold ID	JGI24653J20064_1016596 Open in IMG/M
Source Dataset Name	Marine viral communities from the Deep Pacific Ocean - MSP-103
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	599
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	21.0597	Long. (^o)	-150.4292	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065860	Metagenome	127	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24653J20064_10165961	F065860	N/A	SNNEFLYFKYRKIIGNGILKMATELKTDKISPSTANQVEIEVAEEQMILIDADGNVQVATAWNPSLSTTGKAFVIGX*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.