Scaffold JGI24523J20078_1011753

Overview

Basic Information

• Taxon OID: 3300001718
• Scaffold ID: JGI24523J20078_1011753
• Source Dataset Name: Marine viral communities from the Pacific Ocean - LP-48
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1175
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location

• Location Name: Pacific Ocean
• Coordinates
  • Lat. (^o): 50.0005
  • Long. (^o): -144.9964

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064886	Metagenome	128	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24523J20078_10117534	F064886	GAGG	MAVTKAMTKAIPSEKSSKAQEWNLEMKYENDSEGDATYYTSTFSHIARAADGDFTAAAKGSFNLAAL