| Basic Information | |
|---|---|
| Taxon OID | 3300001687 Open in IMG/M |
| Scaffold ID | WOR8_10003083 Open in IMG/M |
| Source Dataset Name | Deep Marine Sediments WOR-3-8_10 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 16317 |
| Total Scaffold Genes | 14 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 13 (92.86%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River estuary, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 34.640199 | Long. (o) | -77.109447 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F003637 | Metagenome / Metatranscriptome | 476 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| WOR8_1000308313 | F003637 | AGGAG | MAKVIAEKVQEAVQADSTKIVEIKHTRTMQDASGNDVVVVDYTEEKLVDDAISECETNIASLQTQLTEFEAELADYIAIRDAE* |
| ⦗Top⦘ |