Scaffold JGI24024J18818_10039864

Overview

Basic Information

• Taxon OID: 3300001685
• Scaffold ID: JGI24024J18818_10039864
• Source Dataset Name: Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1790
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine → Marine Microbial Communities From The Santa Barbara Channel Oil Seeps

Source Dataset Sampling Location

• Location Name: Coal Oil Point, Santa Barbara, CA
• Coordinates
  • Lat. (^o): 34.39192
  • Long. (^o): -119.84578
  • Depth (m): 47

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041207	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24024J18818_100398642	F041207	AGG	MMHKATRQEELDRIDALTIIEAVAYANRLNIRLRRNSCTDEERMNGLELFEHLTERVHFLKITLEPAFPQTGASY*