| Basic Information | |
|---|---|
| Taxon OID | 3300001684 Open in IMG/M |
| Scaffold ID | JGI20128J18817_1008382 Open in IMG/M |
| Source Dataset Name | Hot spring microbial communities from Joseph's Coat, Yellowstone National Park, USA - JC2_E |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2134 |
| Total Scaffold Genes | 8 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (62.50%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Elusimicrobia → unclassified Elusimicrobiota → Elusimicrobia bacterium GWA2_38_7 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Microbial Mats → Hot Spring → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Joseph's Coat, Yellowstone National Park, Washington, USA | |||||||
| Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063847 | Metagenome / Metatranscriptome | 129 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI20128J18817_10083823 | F063847 | AGGGGG | MRFKRYVFCYDVYSVSSDMVETHKVSIYAKSLKEAKSKLEKLGYRNLYQKKKRKVSY* |
| ⦗Top⦘ |