Scaffold GBIDBA_10023483

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBIDBA_10023483

Scaffold GBIDBA_10023483

Overview

Basic Information
Taxon OID	3300001683 Open in IMG/M
Scaffold ID	GBIDBA_10023483 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12349
Total Scaffold Genes	19 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (52.63%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Guyams Basin, Gulf of California, Pacific Ocean
Coordinates	Lat. (^o)	27.015833	Long. (^o)	-111.425	Alt. (m)		Depth (m)	1993
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076178	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
GBIDBA_1002348313	F076178	AGGAG	MAIPDNLALGDYNKVTEVGSSTTYHATGSNSGAGFIVENLTNVVIHCSSGGTLDSGQLTTKTLYPIGVRKVVIGATGVVFVLHR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.