| Basic Information | |
|---|---|
| Taxon OID | 3300001683 Open in IMG/M |
| Scaffold ID | GBIDBA_10022337 Open in IMG/M |
| Source Dataset Name | Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 3276 |
| Total Scaffold Genes | 6 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Proteobacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Guyams Basin, Gulf of California, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | 27.015833 | Long. (o) | -111.425 | Alt. (m) | Depth (m) | 1993 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024333 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| GBIDBA_100223374 | F024333 | GGAG | MSIGFKDKFGMWLDDVKDRIYNVLGQNKSEKEEDLYETRWVWYHTLLVVELFIIIILLVFIAI* |
| ⦗Top⦘ |