Basic Information | |
---|---|
Taxon OID | 3300001681 Open in IMG/M |
Scaffold ID | Abe_10152624 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1112 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Abe, ELSC, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.111307 | Long. (o) | -176.989014 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F052873 | Metagenome | 142 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Abe_101526243 | F052873 | N/A | SRVPKVRRKTKFNIAVSAGMKAVKGSTSYGKKGTISNAKKAFTVVTKTASKINKGAKVAKSGITRKIGLVAKRILK* |
⦗Top⦘ |