Basic Information | |
---|---|
Taxon OID | 3300001681 Open in IMG/M |
Scaffold ID | Abe_10026922 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 3268 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (30.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Abe, ELSC, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.111307 | Long. (o) | -176.989014 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002426 | Metagenome | 560 | Y |
F030294 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Abe_100269228 | F002426 | N/A | MSGLQTRTYTLAAASLTAGTFAAITGLLGASQSTTNPEGMTKVVRISMSCSPDHTSATDGVSVFAFKGDGVSVQQIMAGPSWSNQAAGPLDGNNGQPVVMESSTGLFDIIPGNQIDFSVSATTAETVDVAVSITYAP* |
Abe_100269229 | F030294 | N/A | MITPHPSITGMAAGFSLVDDLNKGGVVDQVLAGKYGAALNTLSFNSQALIKTDVGRKALVQAVGIAAIGAWARKALPATKIGGSKFYFKI* |
⦗Top⦘ |