Scaffold Abe_10021105

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Abe_10021105

Scaffold Abe_10021105

Overview

Basic Information
Taxon OID	3300001681 Open in IMG/M
Scaffold ID	Abe_10021105 Open in IMG/M
Source Dataset Name	Black smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3684
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Abe, ELSC, Pacific Ocean
Coordinates	Lat. (^o)	-20.111307	Long. (^o)	-176.989014	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005580	Metagenome	396	Y

Sequences

Protein ID	Family	RBS	Sequence
Abe_100211056	F005580	AGGAG	MKAIPHPSVTGMASGLAIAAYLNAGKSVTGSFGKTSIVEGVIKDVTDGQLGTAFSTLSSNAVDMIGTDDGRKTLVTASLVAMLGAFARKQFPQLKLGGSKLYFRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.