| Basic Information | |
|---|---|
| Taxon OID | 3300001680 Open in IMG/M |
| Scaffold ID | KiloMoana_10034291 Open in IMG/M |
| Source Dataset Name | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2260 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Kilo Moana, Lau Basin, Pacific Ocean | |||||||
| Coordinates | Lat. (o) | -20.054108 | Long. (o) | -176.133522 | Alt. (m) | Depth (m) | 2600 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F000713 | Metagenome / Metatranscriptome | 925 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| KiloMoana_100342914 | F000713 | AGG | MPLVKKNISVAAGATSDQILVGTPYEYVGPNTRLVVAAAESTGTYSGKVTMDFKVNNTEFSSDVAVSAKVTGEAFGWNNTGYVLNDMITTGAERNRPVITFTNNDASSVDVEVAIFIGG* |
| ⦗Top⦘ |