Basic Information | |
---|---|
Taxon OID | 3300001680 Open in IMG/M |
Scaffold ID | KiloMoana_10028959 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2509 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (83.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Candidatus Thermoprofundales → Marine Group III euryarchaeote | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kilo Moana, Lau Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.054108 | Long. (o) | -176.133522 | Alt. (m) | Depth (m) | 2600 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F083429 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
KiloMoana_100289595 | F083429 | GAGG | MARRSSKGTSYGKSFRKKGSKGKHRKGTMIRYKYVNGRRVGAVKSRKR* |
⦗Top⦘ |