Scaffold KiloMoana_10028283

Overview

Basic Information

• Taxon OID: 3300001680
• Scaffold ID: KiloMoana_10028283
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Kilo Moana, Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2548
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Kilo Moana, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Kilo Moana, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.054108
  • Long. (^o): -176.133522
  • Depth (m): 2600

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030294	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
KiloMoana_100282833	F030294	AGGA	MARRKMITPHPSITGMAAGFSLVDDLNKGDVVGQLLKGNLSGAVNTISSNSQALIKTDPGRKALVQAVGIAAIGAWARKALPATKIGGSKFYFKI*