NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TahiMoana_1043469

Scaffold TahiMoana_1043469


Overview

Basic Information
Taxon OID3300001679 Open in IMG/M
Scaffold IDTahiMoana_1043469 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1386
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameTahi Moana, Lau Basin, Pacific Ocean
CoordinatesLat. (o)-20.682131Long. (o)-176.183363Alt. (m)Depth (m)2230
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018195Metagenome236Y

Sequences

Protein IDFamilyRBSSequence
TahiMoana_10434691F018195GAGGMYKAICDNCNGNGHINITDNKGVTEPKQCWICNSEGEIKYEEDFINKLITNHHHR

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.