Scaffold TahiMoana_1029422

Overview

Basic Information

• Taxon OID: 3300001679
• Scaffold ID: TahiMoana_1029422
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1850
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Tahi Moana, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.682131
  • Long. (^o): -176.183363
  • Depth (m): 2230

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030294	Metagenome	186	Y

Sequences

Protein ID	Family	RBS	Sequence
TahiMoana_10294223	F030294	AGGAG	MARKMITPHPSITGMAAGFSLVDDLNKGGVVDQVLAGKYGGALNTLSFNSQALIKTDIGRKALVQAVGIAAIGAWARKALPATKIGGSKFYFKI*