Basic Information | |
---|---|
Taxon OID | 3300001679 Open in IMG/M |
Scaffold ID | TahiMoana_1019622 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2479 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tahi Moana, Lau Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.682131 | Long. (o) | -176.183363 | Alt. (m) | Depth (m) | 2230 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F042643 | Metagenome | 158 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
TahiMoana_10196221 | F042643 | N/A | EYLLSYSLFLECRMAFKLKTGKTINKVLAGAGVVALLGIVGNAVAPGFMSSTMGKAVEGIAAYSIGGVESVIGAAATMFIGPGRGSTALDNTLTQTL* |
⦗Top⦘ |