Scaffold TahiMoana_1015314

Overview

Basic Information

• Taxon OID: 3300001679
• Scaffold ID: TahiMoana_1015314
• Source Dataset Name: Black smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4806
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (37.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean

Source Dataset Sampling Location

• Location Name: Tahi Moana, Lau Basin, Pacific Ocean
• Coordinates
  • Lat. (^o): -20.682131
  • Long. (^o): -176.183363
  • Depth (m): 2230

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014746	Metagenome / Metatranscriptome	260	Y

Sequences

Protein ID	Family	RBS	Sequence
TahiMoana_10153143	F014746	AGGAGG	MGLKQPMMYEMPPPPAVDPEVAAKEAESKAKLEAEKKKAISARMKGRGGTILTGGEGVTEEAQTGKSILQSY*