Basic Information | |
---|---|
Taxon OID | 3300001678 Open in IMG/M |
Scaffold ID | Mariner_1041977 Open in IMG/M |
Source Dataset Name | Black smokers hydrothermal plume microbial communities from Mariner, Lau Basin, Pacific Ocean -IDBA |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1235 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Mariner, Lau Basin, Pacific Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Mariner, Lau Basin, Pacific Ocean | |||||||
Coordinates | Lat. (o) | -20.180059 | Long. (o) | -176.601242 | Alt. (m) | Depth (m) | 1900 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F002426 | Metagenome | 560 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Mariner_10419773 | F002426 | AGGAG | MAGLQTRTYTLANTDVVAGTFTSISQLLGSSQSTTNPESMQKVVRISMSAAPKMDSATPGCSVFKFAGDGVSVQQIFTGPSWSVQAAGPLGGNNGDPVVVENAAGLFDIIAGNQIDFSVSCTTAETLDISLSITYAA* |
⦗Top⦘ |